SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015368m|PACid:19692335 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015368m|PACid:19692335
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000011
Family F-box domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Si015368m|PACid:19692335
Domain Number - Region: 73-124,191-225,291-315
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 0.0641
Family TolB, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015368m|PACid:19692335
Sequence length 381
Sequence
MAYDGSCLPDDVLVQILLLIPASSRRPLRLVCKGWRNVIDERAPPEENLPRKILVFMNQG
RSCSALVFDGSGRHRTHAWAFTSSSDEGRVHMVGTCNGLLCLHDHTTYGGISLSAVMVTN
PVTGETVALPPVPTRWAWSQFAKGPGKYSFGFHPETKLHKVVHIPRGQRRSVDAVQVFTL
GAGGKAWREPVSVGGSTYWLAAASSGSGTGRVMALDLGDERVTSLDAPPAMGPAPTRSTA
RDTWRLTKVRASLGVMVSSVGMSLISVDVWVLDGGGAEKPQWERRYSVAQTAWSSWVMAP
QLTHGDWILSASRDEWNYTSSWRRKRQLHRRKVGELTDGGGTGRQLPPPKGAQLIMSTEE
RECEFTTFAYVETLNPVPRSK
Download sequence
Identical sequences K3YM89
Si015368m|PACid:19692335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]