SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015369m|PACid:19693217 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015369m|PACid:19693217
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily F-box domain 0.0000000484
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 128-176
Classification Level Classification E-value
Superfamily L domain-like 0.0000771
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015369m|PACid:19693217
Sequence length 379
Sequence
ALPEGILEHILGFLPAPEAVRTSVLARSWRDLWKSATGLRIGCRGDDSLKSVKELREFVD
HVLLRRGDAPLDTCDFRFGEFQQEDVPHVNQWLRHAIVCKVRVFILSIISDESPSPWLEL
DDLPHASQQLTRLELSFVQVRNSFLNFTSCPLLEHLVLEYNDLEGRTPILDSMPSLIKAF
VRITPDCEDACDKLLDPNCSQCECQYCGTSVNVGDGNNSHVLLKGLSEAKDLDLESAHDM
LKTLLLNEYWCMPGDFGALACILEHSPVLEKLALELFSEGPKYKVEMEGSFTVEKSATIS
EHLNIVKVKCQDVDERVLKVLKFLCTFNLLCSELVCHISSLIISLHRKFNCSKLKWFQFL
IRGASRKYELPRDLLPLTV
Download sequence
Identical sequences K3YM90
Si015369m|PACid:19693217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]