SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015376m|PACid:19691897 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015376m|PACid:19691897
Domain Number 1 Region: 103-245
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000647
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 
Domain Number 2 Region: 11-63
Classification Level Classification E-value
Superfamily F-box domain 0.000000000602
Family F-box domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015376m|PACid:19691897
Sequence length 266
Sequence
MDVKPSLLTVSSVRDWSELPLDALSTIFMKLGTIEILMGAGLVCRSWLAAAKSPELWRFV
DMTGHKMVNNMVNGDPGILCAMAKVAIDRSDGQMESFRAQLFVTSELLDYIESRANSLKS
IQLTNCWYLWTQKLSRFASKCPLLEEIEFSYQKMLPELIRHLGSVHPNLKRLRISLPSIW
QNGVHMEYDESWEAGKNEEAFAIAESLHELRFLQMAGRCLSNDGVYAIIQGCPHLECLDI
TKCCHVYVNDELRAHCAKIKCVLFPK
Download sequence
Identical sequences K3YM97
Si015376m|PACid:19691897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]