SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015381m|PACid:19692102 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015381m|PACid:19692102
Domain Number 1 Region: 189-252
Classification Level Classification E-value
Superfamily RNI-like 0.00000000569
Family 28-residue LRR 0.048
Further Details:      
 
Weak hits

Sequence:  Si015381m|PACid:19692102
Domain Number - Region: 13-56
Classification Level Classification E-value
Superfamily F-box domain 0.018
Family F-box domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015381m|PACid:19692102
Sequence length 345
Sequence
MDQYPIPLPKSPVRDWSQLPLDPLSSIFMKLGAIEILMSAGHPELWRFVDMTRHKLVFLK
NVGTMCAMAKVAIDRSGGRMESFWAQQFVTSELLDYIASRYEKCPLLEEIECSYHARPAE
FYGYVGNVRPQLKRLRIHVEKGYDSDEIEREMEEERRQQLGSDEEDEDEESEEESFEAWK
ARKNKDAFAIAESLHELRLLQMAGNSLTNKGLYAILDGCPHLECLDISSCSNLPLDNKLR
ARCARLKHVWLPGQLNRVRCPDLHVIREHEGEDYSNIVRSLSEDEDMHLCAEEETDDGSY
GGNYWQDYSSSPPSSPDASSGPDELSKVTCDDTRFYTDIHEYYSL
Download sequence
Identical sequences K3YMA2
Si015381m|PACid:19692102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]