SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015437m|PACid:19690943 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015437m|PACid:19690943
Domain Number 1 Region: 162-378
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000239
Family Cyclin A/CDK2-associated p19, Skp2 0.064
Further Details:      
 
Domain Number 2 Region: 30-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000157
Family F-box domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015437m|PACid:19690943
Sequence length 437
Sequence
MENYLMGRGAASNDSQDKTICNRRKANIKFEDLPEDVQCTILSKLPLKEVVRASVLSSEW
RYLWVNCPKLCFNRAEMSGHKRCMKKFIDTVNAVLQKCRGDVVEEFKVKFGFDTTLADHV
NSFISFAASSRVKVLAFDLEPFDSGLRYDHYIFPFDLFNNESISCLQSIQLSFVSLEPPF
QFSGFPNLRKLDLRVVHVTRKDLEDTLSSCCNIEWLSMDRCHLKDELKVDTPMFHLQHLR
IVHCELTKIEFHAVNLDTFVYKGSFLPIVLNHSRKLDDVRITLYQTIFQHVLAALLDGLP
SMKNLTFHIYFPRIEMQGLRNNPYKFSRLRNLQLFMNIDRKDADKLFCLVSFLRAAPLIE
RLEVHVIWIYGFDPYLWFADVGPERQNLQQYEYKHLKSMYITGYKGARGQLEFILHVVEN
APVLEVLTVHTTRAVLE
Download sequence
Identical sequences K3YMF8
Si015437m|PACid:19690943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]