SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015506m|PACid:19692683 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015506m|PACid:19692683
Domain Number 1 Region: 27-63
Classification Level Classification E-value
Superfamily F-box domain 0.000000229
Family F-box domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015506m|PACid:19692683
Sequence length 298
Sequence
GGDGPHGRPQRPLPRCDPPSPPLPGYLARAAAVCRHWRRVASSPALLRLFRRLHPPPLLG
FFICNDGFIVEKVNGVLIGEILSPTFFTSNPEPPGLSGVVSRCINFSLDSLPDVERWALA
DTRDGILLFCASFSAHDRLQIPSHFVVCDPVTGRSVLIGDAPLHESAYLGASLLLTDGRL
SFEVIVVTYFMWGPRLLVFSSHSGGWTVHPYADVGGRSIMTMLGSVGYDMHANGCVYWVI
NDEEHEASEYLMALDTRLDSIHAGVKLTRLDARWFDAKIVALSVTWVLTWQGAWRQRQ
Download sequence
Identical sequences K3YMM5
Si015506m|PACid:19692683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]