SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015522m|PACid:19693254 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015522m|PACid:19693254
Domain Number 1 Region: 46-86
Classification Level Classification E-value
Superfamily F-box domain 0.00000000523
Family F-box domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015522m|PACid:19693254
Sequence length 477
Sequence
MPQAKRARNASRPRSSAAAAADPPRSSGWFSGRRGPSASRRADDDGTPLHEEIILFIFAT
FLDIADLVRCAATCRRWRRLVSGDAAFICRGLQRPGPGGKFIPPLAVGYFRQHDADTIHF
VPMAPALRRFPLLREPTSPSVMLVGDVRFDTSRIVTSRNGLIVIELRRGKHSRTLKLCVC
NPMTGEVRALPPLTGKDGVGYYACTVLTADDYQYQVQNSDAGTPPPSASHYRLLMVYNRR
DFTAFRSYSSEDGGGWGPERKVTGARLGKRHMRLTHGGVVACGGRAAYWKTSGGGVFGLR
LDTLEATKVSLLEVVGGGEAPAFNVLNTLLGMAPDGRLCAVQLSLPFLQTQQDTITIRVT
SCGGGHGGVVDNGILQQGNCLWMKESSIKIMHSFPGNVHSTKVKLQWFCEKSGLVFFTAG
KNDGDQRGDLYTLSLSTRVVEKVASNAWDGNMWDNLYGYEMDQAAYLASLAGTEKED
Download sequence
Identical sequences K3YMP1
Si015522m|PACid:19693254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]