SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015541m|PACid:19690637 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015541m|PACid:19690637
Domain Number 1 Region: 13-66
Classification Level Classification E-value
Superfamily F-box domain 0.000000196
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015541m|PACid:19690637
Sequence length 406
Sequence
MDGKRKRKRTPRLPPYLKEEVIIEILVRLPVKALSVSKAWRAIISDPIFIQAHLRRSASN
WQEDPCFIYVVADEDGPGRWPTTFCNHIRFYQWQLGNKVATFIHDDNEYSCNSFDQRYFS
HCDGLVLAPTDTRLYVFNPATRDAITLPESGRNDLKRRGGEPRACYCFGLGLDPRIGKYK
VVQGFYWSKDCTSMGMEVCTIADDDDHRGIWSWGKIRNDPPYLPQGCQTAPSINGYMFWR
IADQPGKQQQPPRALLHLSLDDEEFGITRLPDSLDPSLVHTFHLDVLHGRELCLTARTIG
TMLTIWTLPVVDKGLNSPWERRYSINVSGIFHTMALPPCSSSGIILRRAEAIYRYDLKTC
KLTTLCEMDRMALQGRRTKRQRKYDLFTFDIKRYTESLVRITNRLQ
Download sequence
Identical sequences K3YMQ9
Si015541m|PACid:19690637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]