SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015551m|PACid:19691447 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015551m|PACid:19691447
Domain Number 1 Region: 203-352
Classification Level Classification E-value
Superfamily RNI-like 4.51e-16
Family 28-residue LRR 0.014
Further Details:      
 
Domain Number 2 Region: 116-178
Classification Level Classification E-value
Superfamily F-box domain 0.000000000445
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015551m|PACid:19691447
Sequence length 424
Sequence
MPSSAASRRRGRNEPPPPAPHPEPVEQEMGPAAVPRLPPPAVFAGKLDPAPDTAPVERAR
GPVAAPCLPPPANFARMPGPAPRVASSPSPSPHKLQARPPTPPPPSSSSSSSRRRRRKAS
EDQEARDWASLPRDALADVLRKLGHIEILMGAGQACRSWRRAALEDPLLWRRIDMRGHAD
LFNQVNLHGMAQAAVRRRRPVAPSLKSLRLISCYDVSNEGFAEAIKKLPLLEELELSLSS
NVFGQEVFETVGKSCPQLRRFRLSKHGFCSFEAADYNMDGEALGIANMTELRSLQIFGCS
FTKFGLKVILDSCHHLESLDIRHCFNVEMDNILRAQCAGIKTLRLPDDSIDDYEFVVAAP
IWDDHSQSEDDSDGDYMGSDVYYELDTELDDDDDIYDPSNYIDGMDKDDEEARMILRSLW
ALMK
Download sequence
Identical sequences K3YMR8
Si015551m|PACid:19691447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]