SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015561m|PACid:19693284 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015561m|PACid:19693284
Domain Number 1 Region: 98-237
Classification Level Classification E-value
Superfamily RNI-like 8.04e-17
Family 28-residue LRR 0.058
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000353
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015561m|PACid:19693284
Sequence length 266
Sequence
MDWADGLPADVLLAILHRLDHIAILLAAGGVCRSWPRAAREEPSLWRRITMRGHEGIARW
LNRCGVACEAVRRAAGQCEAFCGEYAGDDGFIVYLTEQAPSLKSLRLISCNGVTNEGVAE
AVKELPLLEELELSLCDNVGGSEVFEVVGEACPQLKHFRLCKKRFDVTVRNKDNDVRGIA
TMHGLHSLQLFSNLLTNKGLETILDNCPHLESLDIRYCFNIDMDQTLLLKCARINTVRIP
DDPIDDYNLEVQSPIRTYCFRFRFRI
Download sequence
Identical sequences K3YMS8
Si015561m|PACid:19693284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]