SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015569m|PACid:19690739 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015569m|PACid:19690739
Domain Number 1 Region: 147-346
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000408
Family 28-residue LRR 0.056
Further Details:      
 
Domain Number 2 Region: 13-55
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000288
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015569m|PACid:19690739
Sequence length 412
Sequence
SGSKSAKALDFGDRISGLPDELLHHVMSFLPARDAVRTCVLSPRWRYLWASARHLNVDTE
GFTTQRTFKKIVTALLLSRGYTPLDSFCLDADVPGFYLENFRDTAYLWICHALRSNVHTL
SITDHDRNDAFIEFQDFEDDPDAFQIDHCPFTSSYLKRLHLCGVFILECFLKKLFSGCPA
LEDLDIINCVIHDTEFSSATLKNLSIDFDSFPSCEMYGFKNIVINMPSLVSLHIGAFLGA
LPSLVNVQSLRTASICLDDQGATFADGCNILGALSNVKNLELLFLYGVSGRYSLQSDMQL
CQVSFTNLTTLSVSDWCLHDNCKALLYMLEHSPNLEELTLKMRKLRLHEYIDSSCSAAAA
DSAAPFNCEKLRKVEIVCPKGDKTVGMLVTILLTELMSPPEISIKPFSGFSW
Download sequence
Identical sequences K3YMT6
Si015569m|PACid:19690739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]