SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015595m|PACid:19693239 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015595m|PACid:19693239
Domain Number 1 Region: 36-87
Classification Level Classification E-value
Superfamily F-box domain 0.00000000119
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 142-221,387-481
Classification Level Classification E-value
Superfamily RNI-like 0.0000000286
Family 28-residue LRR 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015595m|PACid:19693239
Sequence length 524
Sequence
MFPRATKRRVPVNGPGEASSSRGHTGGDGGGTDLAADRLSAFPDALLHHVMMFVKAWDAV
RTCVLSRRWRDLWASAPCFVYRLLLAREAFAPVDTLRLRLRGKDDDDEFDTDVRMWIRHA
IRRKVRVIQLTGHAIVFARLDSMDFVSRHLKILKLSYANVFDSFTMKLSSQCPSLEELEL
KDCLVEGHGIIHVSLKRLTMVKCAFLKNFLVDAPNLVFVRCIAPERWVPLFKNFEALVTG
SVMFDDSLLSYEFGYQVDDDEFAQTSDDDDDDNNSTYARSIGKPITASDDSDEFISDDSD
FSDDFCDEYSDDVKDSHDYGSDINSDSGTYEYSEIANGHEYKQFENLNDGHDCTKGSNYH
GCNAMYATSDYKSLGGQNVLHSLSNAQNLELLGHLGEVVLRRESISCPTFSNLKTLTLGE
WCISTGADFDILVLLLQYSPTLEKLYLHLEKNPDIQKALEGGIKPKGGLFSCKHLSMVRI
RCTKGNPRVHMLAQLFRYNGVLLEKIYVRRSGSFCEYYLMSISL
Download sequence
Identical sequences K3YMW2
Si015595m|PACid:19693239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]