SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015639m|PACid:19692830 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015639m|PACid:19692830
Domain Number 1 Region: 180-328
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000199
Family Rna1p (RanGAP1), N-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 80-143
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000497
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015639m|PACid:19692830
Sequence length 439
Sequence
MASSAAAPRGRRNHPAPPPEAVERAAGPAAVPWLPPPAAFARKLDRAAATDAPPAVAVPW
LPPPAAFARRLRPAPPDPNTPEPQTPTPRGWAALPRDALVAVLRKLDHVEILMGAGRVCR
SWRRAARDDPALWRRIDMRGHADLHRRVDLCGMARAAIHRAKGRCEAFWAEYAADDDVLQ
LLGEQAPSLKSLRLISCQDIIGFQEEIKKFPLLEELEISLFTNIGGKHVFEAIGQSCPEL
KHFRFNSYRFINLGNREYSYDDGDDDYYDYDDNDLKYKDADALGIAYMHGLCTLQLFGNN
LTNEGLTAILDNCPHLESLDIRHCFNIIMDDTLQARCARIKTLKLPSDPTDDYGFPVCSP
LWSSGIDSDSDALGSFGTYSDGDDCVYGDYILDSDEYDDYCDPFRYLNGVYEDELGVQDR
MFLKGMRMLMRNDDDDDDY
Download sequence
Identical sequences K3YN05
Si015639m|PACid:19692830 XP_004974366.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]