SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015685m|PACid:19691637 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si015685m|PACid:19691637
Domain Number - Region: 10-70,120-144
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0602
Family Tricorn protease domain 2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015685m|PACid:19691637
Sequence length 328
Sequence
LYPDHSKLHGFVRFFNLSTGDFVRIHLPLFRDHCVLDSIDGILLLHRDHDTAIRLLNPFT
GDILDFPPLETLLRYVSPTIIAAASINVSLDEVVPIMIVGSPAMKVAFATSREQQWRVSS
WSLQQTFSPSPFQGKLYVVRDCGGFTGPEILEIDPPQLEGMEPRVPPPRSIAKCPVSKSD
GPTRYHLVERSSEILVIARSFGITKKISAYRLADLMLGRNVLMTCIDGDALFIGERNLCV
GSNAFPTIVGDTIVFHHREKRYLAQYHVSSGTLSPASDGSIVGCAIPSPCSIIFHIYTCC
YRQQWNKGQIKFQGEMNWWRVKGKWRIG
Download sequence
Identical sequences K3YN48
Si015685m|PACid:19691637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]