SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015705m|PACid:19692172 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015705m|PACid:19692172
Domain Number 1 Region: 6-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000209
Family F-box domain 0.0048
Further Details:      
 
Weak hits

Sequence:  Si015705m|PACid:19692172
Domain Number - Region: 156-216
Classification Level Classification E-value
Superfamily YWTD domain 0.017
Family YWTD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si015705m|PACid:19692172
Sequence length 367
Sequence
MVALPSSWENLPPDLLDLVLHLLPSLADRVRLRAVCRPWRAAAQRKPRLPPPLPCLALRD
GTLVDLQGAPVRCAPILRERVFRYLAVDDLAFLVHDDGACSLTNPLSGILSSPLDSTPDP
FIAIIIMEGYGIAVSACKQLDAISAMIPDPQRTRSTRRIYDIAFFNGKLYAITEYDGLQA
LELDVGRLHEPNSSSRFHKCIAEDPKQQRIYRATDDIDYLVLRYLVECSGKLLMIRRWMS
FPHEARVGDHDRTSWFEVFETDLATVPGQWINVDSLDGLAIFLNSECSKSVLASKCAGGV
QEDCIYFMHRVFDNPSMQYFGPCVNPLGDSGVCNMRDGNITPLLPEAVMTELRCKQQYLT
WFFPTGS
Download sequence
Identical sequences K3YN65
Si015705m|PACid:19692172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]