SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015715m|PACid:19691981 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015715m|PACid:19691981
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily F-box domain 0.000000000445
Family F-box domain 0.0073
Further Details:      
 
Domain Number 2 Region: 141-280
Classification Level Classification E-value
Superfamily L domain-like 0.00000374
Family Internalin LRR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si015715m|PACid:19691981
Sequence length 418
Sequence
MEDLPKEIQNLVLSLLSLKEAARTSLVSRSWRKLWTRYPNLCFDGSKDGSTDVDSVKIER
PKFIETVNSIIQQHSGIGLDKFSVRYSLRMDSDILNRWICFATGSKANIINMNLRPKGNY
VGPTKQVHHFPLEALGAQGRPFIRCLFLTNVSIKPHSDICGFTKLRSLHLHCIQIIGDLS
GLLLSCSILEDLELIACSGMIRFNVPNLSRFGYKGTAIPIVLHGCSKLQKATLTFHPTWL
EQDNNKVLGHVFHGIPSVSAVKMLHVHANMHTNLPVWSSQVHTSTTRPACMFLNLKHLTY
EILIFTKAPNRHSGILQLSRSLLLMMHFVPVAFGHCWHGEGVSYHMRRHDHLKTVYMSGF
RCYRAQVELLCGILEMGAVLEHVTIEPMVRIPCSPGSVNLGIPQGEICEWAHRTQNGL
Download sequence
Identical sequences K3YN75
Si015715m|PACid:19691981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]