SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si015847m|PACid:19692748 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si015847m|PACid:19692748
Domain Number 1 Region: 87-247
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000432
Family 28-residue LRR 0.025
Further Details:      
 
Domain Number 2 Region: 6-62
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000301
Family F-box domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si015847m|PACid:19692748
Sequence length 252
Sequence
METAGRDWSELPLDALMLVFARLGPVEILMGSGLVCRSWLQAAKEPELWRSVDMANHRVV
EEMKGDVLCAMAKLAVDRSMGQLEVFLGKYFVTDELLKYVGARSASLKILSLTSCHEVSN
KGFTELVTKSPLLEDLSLELCPKVGGRNVYESTGKACRQLKRFSLRRECFRFSLNYPRRV
AEALGIAATMSELRSLSLISSNITNEELVAIVDGCPRLEILCLRDCYKVIADDPLRAKCD
RIKTLTLPEYDR
Download sequence
Identical sequences K3YNK5
Si015847m|PACid:19692748 XP_004972638.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]