SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016151m|PACid:19688091 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016151m|PACid:19688091
Domain Number 1 Region: 29-100,249-389,417-489,596-666
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.03e-17
Family Tricorn protease domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si016151m|PACid:19688091
Sequence length 1124
Sequence
MYLAYGWPQSIPLDPDDSDRVVLLRVLGRLLLAVCPASLHLWSAAQHRVRLARFDRSADS
LAAHGQNAHAVWSPDAKTVAVLTSSFYLHIYRVQLSGKPLIVGGKQLPGLCLASISQIIT
EKVPLANGVAITSNFVCDSKSMLLGLSNGHVQVVSWNAEFSDSFKLGCSVCSSEKPTAVI
DALVFDPPSLRENSDARPAPCCTGNSSIVHVELSVKLRLLVALYSGCHIALCTVGKKGLK
QPGSIRVERWLNTDDAMCTSVASEQQILAVGCSRGVVELYDLAENTRHIRTISLYDWGYS
VEDTGPVACISWTPDNCAFAVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSAL
KFEPLMGGTSHIQWDDNGYKLFAVEESLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDD
RILLVQPDDADELKLLHLNVPVSYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKR
WRFFGDVTQEQKIQCKGLLWLGKIVIVCNYVESSNTYELLFFPRYHLDYSSLLYRKPLLG
RPIAMDVFQNYILVTYSPFDVHIFHVVISGELSPASNPVLQLSTVRELSIMSPKSPPVSM
RFIPDQNDKGALKQNASGSSDLLSEQPSRCLILRTNGELSVLDMDDGHEHALTNSVELFW
VTCSQFEEKGSLIKEVSWLDYGHRGMQVWYPSHGADPFKQEDFLQLDPELEFDREVYPLG
LLPNVGVVVGVSQRMSFSTAEFPCFEPSPQAQTILHCLLRHLLQRDKIEEALRLANLSAE
KPHFSHCLEWLLFTVFDADISRPSASKNQVLQKVNSPKKSLLEKTCDLLRNFPEYMDVVV
SVARKTDGRHWADLFSAAGRSTEMFEECFQRRWYRTAACYILVIAKLEGPAVSQYCALRL
LQATLDESLYELAGELVRFLLRSGRDFENATSDSEKLSPRFLGYFLFRSPYKRQSSDLKS
NSMKELSPHIASVMNILESHASYLMSGKELSKLVAFVKGTQFDLVEYLQRERLGSARLEN
FASALELIGQKLQMDTLQSRLDAEFLLAHMCSVKFKEWIVVLATLLRRAEVLVDLFRHDL
RLWKAYSITLQSHDVFREYLDLLNMLEEQLSSVSGLTLQNGPLS
Download sequence
Identical sequences K3YPF9
Si016151m|PACid:19688091 Si016152m|PACid:19688090 XP_012704296.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]