SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016156m|PACid:19688092 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016156m|PACid:19688092
Domain Number 1 Region: 29-100,249-389,417-489,596-667
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 9.15e-18
Family Tricorn protease domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si016156m|PACid:19688092
Sequence length 1109
Sequence
MYLAYGWPQSIPLDPDDSDRVVLLRVLGRLLLAVCPASLHLWSAAQHRVRLARFDRSADS
LAAHGQNAHAVWSPDAKTVAVLTSSFYLHIYRVQLSGKPLIVGGKQLPGLCLASISQIIT
EKVPLANGVAITSNFVCDSKSMLLGLSNGHVQVVSWNAEFSDSFKLGCSVCSSEKPTAVI
DALVFDPPSLRENSDARPAPCCTGNSSIVHVELSVKLRLLVALYSGCHIALCTVGKKGLK
QPGSIRVERWLNTDDAMCTSVASEQQILAVGCSRGVVELYDLAENTRHIRTISLYDWGYS
VEDTGPVACISWTPDNCAFAVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSAL
KFEPLMGGTSHIQWDDNGYKLFAVEESLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDD
RILLVQPDDADELKLLHLNVPVSYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKR
WRFFGDVTQEQKIQCKGLLWLGKIVIVCNYVESSNTYELLFFPRYHLDYSSLLYRKPLLG
RPIAMDVFQNYILVTYSPFDVHIFHVVISGELSPASNPVLQLSTVRELSIMSPKSPPVSM
RFIPDQNDKGALKQNASGSSDLLSEQPSRCLILRTNGELSVLDMDDGHEHALTNSVELFW
VTCSQFEEKGSLIKEVSWLDYGHRGMQVWYPSHGADPFKQEDFLQLDPELEFDREVYPLG
LLPNVGVVVGVSQRMSFSTAEFPCFEPSPQAQTILHCLLRHLLQRDKIEEALRLANLSAE
KPHFSHCLEWLLFTVFDADISRPSASKNQVLQKVNSPKKSLLEKTCDLLRNFPEYMDVVV
SVARKTDGRHWADLFSAAGRSTEMFEECFQRRWYRTAACYILVIAKLEGPAVSQYCALRL
LQATLDESLYELAGELVRFLLRSGRDFENATSDSEKLSPRFLGYFLFRSPYKRQSSDLKS
NSMKELSPHIASVMNILESHASYLMSGKELSKLVAFVKGTQFDLVEYLQRERLGSARLEN
FASALELIGQKLQMDTLQSRLDAEFLLAHMCSVKFKEWIVVLATLLRRAEVKLVEFYHFT
QLEIFYMMLIFWFIWTLGYLSPLTEDPII
Download sequence
Identical sequences K3YPG4
Si016156m|PACid:19688092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]