SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016581m|PACid:19688336 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016581m|PACid:19688336
Domain Number 1 Region: 170-319,374-393,509-609
Classification Level Classification E-value
Superfamily RNI-like 9.42e-28
Family 28-residue LRR 0.037
Further Details:      
 
Weak hits

Sequence:  Si016581m|PACid:19688336
Domain Number - Region: 92-126
Classification Level Classification E-value
Superfamily F-box domain 0.000131
Family F-box domain 0.0037
Further Details:      
 
Domain Number - Region: 369-437
Classification Level Classification E-value
Superfamily L domain-like 0.0782
Family Ngr ectodomain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si016581m|PACid:19688336
Sequence length 665
Sequence
MSTPHSSSTSSSPAPHRASPPQIPQSLTLAPPTASSASPSSSSASGMRDAAEDDSDSPPS
QMSEDDPGGGGGDRWEPDLRGGNGGGGRWAPPDQVLENVLESVLEFLTAARDRNAASLVC
RSWYRAEAQTRRELFIGNCYAVSPRRAVERFGGLRSVVLKGKPRFADFSLVPYGWGAYVS
PWVAALGPAYPRLERICLKRMTISDDDLHLVAKSFPLFRELSLVCCDGFSTVGLAAIAKL
CRHLRVLDLIEDYVEDEDDELVDWISKFPESNTSLESLVFDCVSVPFNFEALEVLVARSP
ALRRLRVNHHVSVEQLRRLMARAPQLTHFGTGAFRSEAAPGGGLSVTELATSFAASRSLI
CLSGFRDVNPEYLPAIYPVCAKLTSLNFSFASLTAEELKPVIRNCINLRTFWVLDTVGDE
GLRAVADTCSELRELRVFPLDASEDSEGSVSDVGLQAISEGCRKLESILYFCQRMTNAAV
IAMSKNCPDLVVFRLCIMGRHRPDRITGEPMDDGFGAIVMNCKKLTRLSVSGLLTDKAFA
YIGKYGKLIKTLSVAFAGNSDMSLQYIFEGCTKLQKLEVRDSPFSDKGLLSGLNYFYNMR
FLWMNSCRLTMRGCKDVAQQMQNLVVEVIKDHPDDEGEAEIVDKLYLYRSLAGPRNDAPP
FVTLL
Download sequence
Identical sequences K3YQN7
Si016581m|PACid:19688336 XP_004953988.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]