SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016594m|PACid:19686602 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016594m|PACid:19686602
Domain Number 1 Region: 190-299,377-650
Classification Level Classification E-value
Superfamily RNI-like 4.51e-42
Family 28-residue LRR 0.058
Further Details:      
 
Domain Number 2 Region: 306-419
Classification Level Classification E-value
Superfamily RNI-like 0.00000683
Family Cyclin A/CDK2-associated p19, Skp2 0.081
Further Details:      
 
Weak hits

Sequence:  Si016594m|PACid:19686602
Domain Number - Region: 62-102
Classification Level Classification E-value
Superfamily F-box domain 0.000229
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si016594m|PACid:19686602
Sequence length 654
Sequence
MPAFCAYEDGGCLVSAPAELSGLFCRGAVQQRKRTLVAASAVAVAAATECLRAAKKQRQQ
QLPLPSLDALPDGCLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELAQAAAAAADT
PALPDLNEEFVMEEDKDDETPADSCVERVLEGKEATDVRLAAMAVVAGSRGGLEKLAVRG
SHPTRGVTDQGLSAVARGSPNLSSLALWDVPLITDAGLAEVAAGCPSLERLDISRCPLIT
DKGLAAIAQGCPNLVSLTIEACSGVANEGLRAIGRCCTKLQAVNIKNCAHVGDQGISSLV
CSATASLAKIRLQGLNITDASLAVIGYYGKAVTDLTLTRLATVGERGFWVMANAAGLQNL
RCMSITSCPGVTDLALSSIAKFCPSLKQLYLRKCGYVSDAGLTAFTESAKVFENLQLEEC
NRVTLVGILSFLRNCSQKFRALSLVKCMGIKDICSAPAQLPLCKSLRFLTIKDCPGFTDA
SLAVVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVK
AHGKSLKKVSLEGCSKITDASLFTIAESCMELAELDLSNCMVSDYGVAILSSARHLKLRV
LSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIVSLEKKLWWCDILA
Download sequence
Identical sequences K3YQQ0
Si016594m|PACid:19686602 XP_004951542.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]