SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si016985m|PACid:19688443 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si016985m|PACid:19688443
Domain Number 1 Region: 171-386
Classification Level Classification E-value
Superfamily RNI-like 9.81e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 2 Region: 18-67
Classification Level Classification E-value
Superfamily F-box domain 0.000000000667
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si016985m|PACid:19688443
Sequence length 501
Sequence
MAGGGGKRRRVGGGGHEDEEEEEMVVEEDRISDLPDALRMQILSLLPLKSAIRTGALSSR
WRCLWEQRWPEPSSVRIRLPPGAAGAAARVEQFGLIDRRGRRRMDCFSLAFHGGQLTQPD
LRRCLDYAAVCEVEDLHLRVDGGAGRGSRGGGGTRGRGMLTVHFPVGSRLLARLSVRGLN
LTAAANAMVATLEVIHLHSVFLTDAALRRVVAACPRLRELDLRYCRRLRRIDFSAVGVPN
LRTFTLVDCSRTTEVRVPMAPRLRSFRLSGAFLSSNILTGAGGSLEHLYLCSGGPENGLP
PTNLPISVPHLSNLSVLTLCSIALQYISAFTAKAVVESKLQSLRELNFLMFGMANSNLAD
IYSFLKTCSCPQLERLFVQLPTNVRDSFTENFLEVAEEEPPKGGLENLWLAKMTNFKGHR
NEMQLVEFLLRKSSCLKKLFLIAPTEDHPQGLRKIQSDVLPSFLKTEIMHLERASANTQI
IFSEPDGPQIQPLHSEVFVRF
Download sequence
Identical sequences K3YRU1
Si016985m|PACid:19688443 XP_004951844.2.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]