SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017034m|PACid:19686242 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017034m|PACid:19686242
Domain Number 1 Region: 126-387,414-432,463-488
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 2.09e-16
Family Tricorn protease domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017034m|PACid:19686242
Sequence length 489
Sequence
MEHHHKPGLRVRLRITAARRRAWLSAGLRSTCHKPPRRDPADSIHKVARREIGGGHRRPP
RPAAPSSSAFSCPEKFRNFQLQEEYDTYDDEVHFLVQLPFLWTRTKIIEIVAAKDVIFAL
AQSGLCAAFNRTTNKRICYLNISPDEVIRSLFYNKNNDSLITVSVYESDRFSSLKCRTTP
IEYIRRGQLNDGFPLFETESLKYPGFVEFDDVNGKVLTFSAQDSTYKVFDLKNYNFLYSI
CDKNIQEIKISPGIMLVIYQKTNCHVPLTILSIEDGSPLKTFSQLLHRNRKVDFIEQFNE
KLLVKQDKENLQIIDVRNSDLIEVNKTEFMTPSAFIFLYENNLFLTFCNRTVAAWNFRGE
LVTSFEDHELWHPNCNTNNIYITADQDLIISYCKVSKQVADCVDSEAGGVSSMGSINMSN
IFTGKCVAKISPSDPTLTIAPRNRGDKSRSTIHSTVSEALEDITALFYDEDRNEIYTGNS
KGLVHVWSN
Download sequence
Identical sequences K3YRZ0
XP_004954135.1.39314 Si017034m|PACid:19686242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]