SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017091m|PACid:19688799 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017091m|PACid:19688799
Domain Number 1 Region: 161-278,358-379
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000447
Family Cyclin A/CDK2-associated p19, Skp2 0.027
Further Details:      
 
Domain Number 2 Region: 35-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000981
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si017091m|PACid:19688799
Sequence length 475
Sequence
MRTKHLIPNHAAGLTYAARDYAIRDDYGGGDGGGSDPFEGFPDAVLGLIVAKLPFRSAVA
ASAISRRWRGAVAAAPALDIDFAVAFPEAPRRRAAFAAAATAALAPRSAPPPPHPLRRLR
LALEGLFDQAFAASAADHLASWLAAAAARGVERLEIRLPRSRLAVLPPSLLACTGLTSLT
LRLDHYALPLPSLTPLTRLSRLHLASVSLKGDDDFFGDLFSHCTELRYLILEQCRISALR
LAGPSRLCSLAITDCTWTEQSSLALFEMPELRTLRYSGAMATRHIIDGEVSLDEVLLAIE
KPQVKPREATLRELIALVGNVRSLLLSPWCIEQFEEWWKVRLDRVRQLSCIIERREEGAL
SIAPLLSNCPNVEELRVSVVPSQGKRRRCSDGECHGVLCSKGVAVKHLKGVRMKYIDESK
SGLELVKLLLKNAPQLETMNIVPSMDGLEQAKFRRRVLKFRKSSRNASIQFCTAG
Download sequence
Identical sequences K3YS47
XP_004953525.1.39314 Si017091m|PACid:19688799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]