SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017123m|PACid:19689482 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017123m|PACid:19689482
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily POZ domain 1.39e-21
Family Tetramerization domain of potassium channels 0.0031
Further Details:      
 
Domain Number 2 Region: 124-366
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000000000122
Family Tricorn protease domain 2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017123m|PACid:19689482
Sequence length 466
Sequence
MCTPAAAGRGRVRLNVGGRVFETTAATLATAGRDTMLGAMLDASWNAGHDADGGAAEYFI
DRDPACFAVLLDLLRTGGLHVPPGVPEAALHREALYYGLLDRVRAARFGDFDGDRLRLAA
SVPGRAPGDGTAVRAAPDGGCCVAHGGAVRVYNWMLEERRPVYCPGHAPVNDAAYLDAAT
LLVAARERPGTGRRGDDGGGGGGGGGVAAFSALTGEPRHRFRVAHGRQPRSFTAGALAFD
DGEGCRVFASCKGRLNEYGVAVWDVNTGEQAGFFYEPPGCALGDADRLQWLDGTGTLMAA
TMFPRADSSFISLLDFRDKSVVWSWSDAGTPASLEDKHAVHAVAMEDGRSVCVINQYHDL
GFLDLRKNAAGVRWRSRSKLTASGKTKTWGEETCYPKLATHGGQLFASTGDAISVFSGPD
HVLTSTLRGGNGGAICDLSIGGDRLFALHSEENVFDVWETPPPAII
Download sequence
Identical sequences K3YS79
Si017123m|PACid:19689482 XP_004953082.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]