SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017150m|PACid:19687232 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017150m|PACid:19687232
Domain Number 1 Region: 15-68
Classification Level Classification E-value
Superfamily F-box domain 0.0000000196
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si017150m|PACid:19687232
Sequence length 460
Sequence
MSHADAGGCPEGGAVDHISGLPDHLLHDVLSRLPGTAAAAARTSILSRRWRRVWTHLPAL
SLCERATSTSFDLKMRVLRCLPLPQSAARSPNRRKRNRIEIPNPSRRAASRRPSEGRGRR
EAAAGGVRGLPWPVARGRGRRRHRGRPQASSHPLSRRRPGGRRHPVPASVHHGGRRRAAF
GIGIGKRTTEQGEMGIPNFQILASPLSTASSDDTTTTNVSDEHLSPPSSPSISFDSVSES
DASTSSSVASDGSSGSEPVVSKKPRLPVRSWLASDEIALLEAVSEHRQKHGRLPSPNHLA
AALRSRLRAKDRLSADEISRRLRALRSRYDNAVLRMSRGTIPVKDDDVTIYKLSKLIWEG
TRKGKREKKTRAADMRKDPREFGELTGLYPCLSAEVEAIDTGSGAAAAGLLKRAFERIGD
DTAARLEAKVKMQRVAEARASAKLDQLRTNVAKVLLQLIE
Download sequence
Identical sequences K3YSA6
Si017150m|PACid:19687232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]