SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017153m|PACid:19689189 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017153m|PACid:19689189
Domain Number 1 Region: 107-128,173-420
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-40
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 41-127
Classification Level Classification E-value
Superfamily F-box domain 0.000000000837
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017153m|PACid:19689189
Sequence length 460
Sequence
MGSILSATGSATAKSMDRHETSGTDPNKRVKVSAYEYGMNRRIIPTLPDELSFQILARLP
LIHYLNLKMVCRAWKAAITSHELSQLRRELGVTEEWLYILSKVEANKLDWYALDPLFQKW
QRLPPMPSFVNEEESNRTGSSGFRMWNVVGSSIRIADFVRSWFWRRNGLDQMPFCGCSVG
VADGSLYVVGGFSKAVALNCVWRYDPFLNLWEEASPMMTGRAFCKATFLNGKLYVVGGVS
RGRNGLLPLRSAEVFDPKTGLWSELPEMPFAKAQVLPTAFLADVLKPIATGMAPYKGKLY
VPQSLYSWPFFFDIGGEIYDPELNSWSTMPDGLGDGWPARQAGTKLGIVIDDKLYTLEPS
SSLDSGQIKRYNSEEDTWVAITPQVPVNDFTDAEAPYLLAGLRGRLHVITKVANNTLQVM
QAVVQNSADNRASEENVLWTPVASRNFGTAELVSCQVLDV
Download sequence
Identical sequences K3YSA9
Si017153m|PACid:19689189 XP_004952865.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]