SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017227m|PACid:19689042 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017227m|PACid:19689042
Domain Number 1 Region: 28-92
Classification Level Classification E-value
Superfamily F-box domain 0.000000000916
Family F-box domain 0.0072
Further Details:      
 
Weak hits

Sequence:  Si017227m|PACid:19689042
Domain Number - Region: 129-299
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0471
Family DPP6 N-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017227m|PACid:19689042
Sequence length 439
Sequence
MLGKCRRPAPRDGDGDGDATAILDDADLEEILLRLPSAADLARSAALVCRRWRRVSSAPA
FLRRFRRLHPPQILGFFICKGGRPHRYDVLNRSPLPVLDPTFLPVVAPNPGVGGAVGRCR
DFSLSSLPTVDHWSLADSRDGLLLFCSSCDRSTNDRDLPDLRDIPKHFAVCDPLSGHSIL
LPKPGAGLYLGSYYLGAALVISDKDEGGTGIFSFEVLIATYVLREGPCLCAFSSSSRQWV
VLPCPDTYELYNYETPWIDDGARDSGHVYWVVHDWGMDYEHILVLDLQTKKFSTINLPCS
GMCDKYNRNIKVMRSEGDRDLRVVAMAWSRCALHFWRHDRSRSAKGRWLKEDVVKFSGVD
GLLDLRMAGGSGNSYLIRIVDAGEGFVFIKHYEAPWVFVLNLKEMTMQKLPNRERFCGHA
LPYRMALSPHLPNFREGNH
Download sequence
Identical sequences K3YSI3
XP_004954286.1.39314 Si017227m|PACid:19689042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]