SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017308m|PACid:19687566 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017308m|PACid:19687566
Domain Number 1 Region: 34-82
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si017308m|PACid:19687566
Domain Number - Region: 196-302,344-388
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00432
Family Quinohemoprotein amine dehydrogenase B chain 0.071
Further Details:      
 
Domain Number - Region: 165-172
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0235
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017308m|PACid:19687566
Sequence length 423
Sequence
MEIERPPRPPLPPPPPVAAAVAAAAAISSVLGDDDLLREILLRLGLPTSLLRAALVCRRW
LSHASDPAFLRRFHDLHPLRLLGAYLSTSAGPNPRLRFLPIRPVPELAGAARRAGGFFDA
FKGSAASIYDSRGDRLLVTTFDDRNDSTHQVCSPLSPAGDTTVVPPPPPPPPIQLANDDE
CVIYQYCEFLPDDGDGGSYFCVVMGYSELQTNVYLYELQDMNWVVRASAAAQLALSPRRS
RVMLFSNEKFYILSATNKILVCDFPSSSISFMELPSGVENKHGGCIMLSRGDGSGIYLMH
VKESQLQIFHCRKDSDNPGNWVLVDYICLRQVCANLDIATWPSVGGHTASVKICAVGDNA
RFVFLEMFGTVVFLDIRSRQAVKVYELTPEDKELVSVRPLLLMWHPVFPLMKNGCNQKEL
CTA
Download sequence
Identical sequences K3YSR3
Si017308m|PACid:19687566 XP_004952294.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]