SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017325m|PACid:19688238 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017325m|PACid:19688238
Domain Number 1 Region: 44-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000497
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si017325m|PACid:19688238
Domain Number - Region: 105-260
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00068
Family Tricorn protease domain 2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017325m|PACid:19688238
Sequence length 419
Sequence
MLAGELVSGNPSKWQCQPTNKAKAVASSRTDDDADDASSGEAGGGPVELLPLHLTEKILY
RISPLASAHLVAVCKPWAATVSERLARPVPHLFVYLPADHGSDRRGVVFSVSMHSGYPPE
VIPSRVRLADTNGLGCVGAMPSGRLAFANFCWCETSVLLVNPITGARQRIHVEKLRGNPV
IAAGGADSFVSIGIGELMFWRRSGGEEWSKRSVAAGGYPLDAIMSVANCNGRFYILDKEG
YVFLVDATAPPPLCIEKLPAASLFDWFAPPRSALATEYGHLLESGGEVLFVRRVLASKED
YREILFCRHGADELLSIVGFEVYRLDVEGRRWTEVKELAGDRALFVSPASSFAVRSSDME
GCRSNCIYFVDKKRYCAQCKRDDGNTWGVYSMEDREVLFKQAVTEQGACSSATWFLPRV
Download sequence
Identical sequences K3YST0
Si017325m|PACid:19688238 XP_004951232.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]