SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017332m|PACid:19686329 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017332m|PACid:19686329
Domain Number 1 Region: 14-74
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000667
Family F-box domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017332m|PACid:19686329
Sequence length 418
Sequence
MPYLRKKRRRAAPPPAAIPQDLLLSEVLPRLPAKHLARFKCVCRSWRAAVESDPAFVRRH
LELSRAAPPCILVIPCEEFYNDDDDDDDDDDGAMSGEISFHRLILGEAPGTADVELVFDK
SWPEGIAHGVLPTHCDGLVAVATAADQIFVCNPATREFVALPPGSRDVLDVKAPAAALGY
DPLRNRYVVARYFYRKYDLSKDVASGALSLDYEIGHETFTLGSGGGDGCWEPTADPPHAI
GPARPVCTREAFYWCTAVRRPSALLRFSLRDRAFDVVPCPPGADYVHGVDHLTELAGKPC
YVQPATETAFDFWVADDDGGPRPEWTLRCRVDFADYGPSVGSDALSVVAAVGDEMMIAAD
HRNLYSCDGRRRKGARLLVDMEEELAYERPDGSTYDGELLHHVVPYVESLVSIGKCNY
Download sequence
Identical sequences K3YST7
Si017332m|PACid:19686329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]