SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017337m|PACid:19686243 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017337m|PACid:19686243
Domain Number 1 Region: 126-386
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000000000392
Family Tricorn protease domain 2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017337m|PACid:19686243
Sequence length 418
Sequence
MEHHHKPGLRVRLRITAARRRAWLSAGLRSTCHKPPRRDPADSIHKVARREIGGGHRRPP
RPAAPSSSAFSCPEKFRNFQLQEEYDTYDDEVHFLVQLPFLWTRTKIIEIVAAKDVIFAL
AQSGLCAAFNRTTNKRICYLNISPDEVIRSLFYNKNNDSLITVSVYESDRFSSLKCRTTP
IEYIRRGQLNDGFPLFETESLKYPGFVEFDDVNGKVLTFSAQDSTYKVFDLKNYNFLYSI
CDKNIQEIKISPGIMLVIYQKTNCHVPLTILSIEDGSPLKTFSQLLHRNRKVDFIEQFNE
KLLVKQDKENLQIIDVRNSDLIEVNKTEFMTPSAFIFLYENNLFLTFCNRTVAAWNFRGE
LVTSFEDHELWHPNCNTNNIYITADQDLIISYCKVSKQVADCVDSEAGGGIAKLQSNL
Download sequence
Identical sequences K3YSU2
Si017337m|PACid:19686243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]