SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017340m|PACid:19686714 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017340m|PACid:19686714
Domain Number 1 Region: 63-389
Classification Level Classification E-value
Superfamily RNI-like 1.05e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 
Weak hits

Sequence:  Si017340m|PACid:19686714
Domain Number - Region: 16-84
Classification Level Classification E-value
Superfamily F-box domain 0.00654
Family F-box domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017340m|PACid:19686714
Sequence length 417
Sequence
MSAPPLGGGGALINEVLTDDELRTVLTRLGPEAERDAFGLVCRRWLRIQSSERRRLRARA
GPDMLRRLAARFPGVLELDLSQNPSRSFYPGVIDDDLNVIAGSFRNLRILALQNCKGISD
VGVAKLGDGLPSLQSLDVSRCIKLSDRGLKAVALGCQKLRQLHITGCKLITDNLLIVLSK
SCLQLEDLGAAGCNSITDAGISALADGCHHIKLLDISKCNKVGDPGVCEIAEVSSSHLVS
IKLLDCSKVGDKSIYSLAKFCHNLETLVIGGCRNISDSSIQALALACSSSLRSLRMDWCL
KITDTSLRCLLSNCKLLVAIDVGCCDQITDVAFQDGEGSGFQSELRVLKISSCVQLTVAG
VSSVIKSFKALEYLDVRSCPQVTRDSCEQAGVQFPSACKVNFYGSLLESDPSAERFF
Download sequence
Identical sequences K3YSU5
XP_004953211.1.39314 Si017340m|PACid:19686714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]