SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017370m|PACid:19687499 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017370m|PACid:19687499
Domain Number 1 Region: 138-349
Classification Level Classification E-value
Superfamily RNI-like 0.00000589
Family 28-residue LRR 0.067
Further Details:      
 
Domain Number 2 Region: 28-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000353
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017370m|PACid:19687499
Sequence length 410
Sequence
MEVDGKGRPCQQDGNSPDSQILGYSGPNLPEDIWCYIHSLMPMRDAAQVACVARAFFCSW
RCHPNLDFSRETLRSIGVKAFKFHVPSVYNGDSAHLDHLDSWLQIAVKPGLNELRLILTT
DGKYNFPCSLLSGETGDPLRYLSLACCHFHPTVKLGCFRSLTKLQLSVVHITASELGWFL
SNSFALEQLKLWYRNDIDCLKIPCLQRLSYLEVVCCTGLQAIESKAPNLSSVWVTGDLHI
QLSLENTCRIKILNRHCSNFTFYARTNLPSIMPNLEALSIRSDIGVIREFKECVSVFEDQ
SDLRMMPGHHPSKLKHVKIIKFSAAKSVAELTCHILESATSLESLTLDTTHGMPRCSVNR
IGKCVFLLKEALVEAQKGVLAAQAFIKPKVPSTVEFNVFEPCSRCYAVEL
Download sequence
Identical sequences K3YSX5
Si017370m|PACid:19687499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]