SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017388m|PACid:19687582 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017388m|PACid:19687582
Domain Number 1 Region: 32-84
Classification Level Classification E-value
Superfamily F-box domain 0.000000000017
Family F-box domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si017388m|PACid:19687582
Sequence length 404
Sequence
MEAHRESSEPAPETASAASAAAAAAASVLGDDDLLREILLRLGLPTALVRAAAVSRRWLR
CASDPAFLRRFRARHPPRLLGFYVNTGDAQRLRFVPLARDPELAAVVRRGSFDLGEEAGS
VRDCRNGRVLVFVGRKYVVCSPLHPGRGNDNLPEPPFPPEAYTLLYYLNDFLFYENTDDS
VSCTSVTVMCSPRQAWVHLSDLQAGVWGEGRYSGMIDLPVPGTLRGCDHHELFSNGKLYM
MCLPHHIVGFDLPSMSSFCIELPDAVQYEYLENIGLSCAEGSGIFLIHLKGFQISVWLYR
TDCSSIGTWKLIDTICLQQAFRHLAELTWDLLPDVIRVAAVGDNADFVLLRIDHKLYYMH
ISSRTVEMVYEASPGHGSLYGVYPFMMPWPPTFPALNGGHDHDQ
Download sequence
Identical sequences K3YSZ3
XP_004952289.1.39314 Si017388m|PACid:19687582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]