SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017493m|PACid:19690380 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017493m|PACid:19690380
Domain Number 1 Region: 99-344
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-53
Family Kelch motif 0.001
Further Details:      
 
Weak hits

Sequence:  Si017493m|PACid:19690380
Domain Number - Region: 37-88
Classification Level Classification E-value
Superfamily F-box domain 0.00706
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017493m|PACid:19690380
Sequence length 385
Sequence
MLAFVGSQEQFSQSQTCLRARMLLKPPTRPKLYSGLMPQEERDSYCDLIPGLPEDLAKIC
LALVPRSHFPVMGAVSKRWMSFLESKELIAVRKEVGKLEEWVYVLTPEAGTKGSHWEILE
CSGQTQSPLPRMPGLTKAGFGVVVIGGKLFVIAGYAADHGKEYVSDEVYQYDSCLNRWTL
LAKMNVARCDFACAEVNGVIYVAGGFGPNGDNLSSVEVYDPEQNRWTLIESLRRPRWGCF
GCSFEGKLFVMGGRSSFTIGNSRFVDVYNPINHAWGEVKNGCVMVTAHAVLGEKLFCIEW
KNQRSLAIFNPADNSWQKIPVPLTGSSRTRFSLGIHDDKLLLFPLEEEPGYQTLMYDPAA
PTGSEWCTSKLKPSGSCLCSVTIKA
Download sequence
Identical sequences K3YT98
XP_004952542.1.39314 Si017493m|PACid:19690380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]