SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017530m|PACid:19686585 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017530m|PACid:19686585
Domain Number 1 Region: 28-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000000018
Family F-box domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017530m|PACid:19686585
Sequence length 377
Sequence
MGRTERKRSGPAAAVPAAVASVLGNDVLLAEILLRLDLPTWLVRAALVSRRWFRGASDPA
FLRHFRALHPPRVLALHANAVGFGRGETRCLPVPQPPGLAAAAPSRRCAARNSATAATAA
CCLLNNGRDEPIPQPPRSNPGSLLRDKRGTCEGSLLRLLENDADSTSCLFLNLRYNDEEL
AAEFSLLQSGVWGVARSTVTELPQRIFDTMVAHKLLVGRKFYMTTALGYILGLDLVTASF
FTVQLPADIWNSTSFRLSRPQQSGLYLIDAKGFQLQVCRGDGMGQWALVDTISVPKVCGH
LNVRRWVPDDAQTAPVSVLAAGENAEFVFLELVASGIVCCIQLSNRAVERVGVGLRMTED
FIRPLTMVWPPVFPVLN
Download sequence
Identical sequences K3YTD5
Si017530m|PACid:19686585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]