SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017588m|PACid:19688444 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017588m|PACid:19688444
Domain Number 1 Region: 186-322
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000366
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 2 Region: 18-67
Classification Level Classification E-value
Superfamily F-box domain 0.000000000432
Family F-box domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si017588m|PACid:19688444
Sequence length 362
Sequence
MAGGGGKRRRVGGGGHEDEEEEEMVVEEDRISDLPDALRMQILSLLPLKSAIRTGALSSR
WRCLWEQRWPEPSSVRIRLPPGAAGAAARVEQFGLIDRRGRRRMDCFSLAFHGGQLTQPD
LRRCLDYAAVCEVEDLHLRVDGGAGRGSRGGGGTRGRGMLTVHFPVGSRLLARLSVRGLN
LTAAANAMVATLEVIHLHSVFLTDAALRRVVAACPRLRELDLRYCRRLRRIDFSAVGVPN
LRTFTLVDCSRTTEVRVPMAPRLRSFRLSGAFLSSNILTGAGGSLEHLYLCSGGPENGLP
PTNLPISVPHLSNLSVLTLCSIALQVCSGIYAISFQPISLPTGLYTCSPLPCSTFLLSQL
RP
Download sequence
Identical sequences K3YTJ3
Si017588m|PACid:19688444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]