SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017610m|PACid:19690537 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017610m|PACid:19690537
Domain Number 1 Region: 4-43
Classification Level Classification E-value
Superfamily F-box domain 0.00000628
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017610m|PACid:19690537
Sequence length 358
Sequence
MAAMGWSDLPPELLTDIAGGITELADIARFRSVCSSWRSAAGDAAAAPPPQPPWLLLPSS
PSRLFFCPREDRIYPDLRLPRPAAEAHHRRRRLYASPHGWALAVDPTDLAASLVHPFNGA
TRPLPPLPAFFKETDDLAWDWSPHGVMVSCGEGIHFCASGPPAADSWAPIPALADCNASS
INYAGGKFFVFEEDVCRTAIVDAVTLAVAAVIPAPAVELPSEARLAVAGDELFLLVKSKW
MYLFGDDVDFSKAFHVNHRGVNPAWQELAGIGDRALFIDSLHGFAVPTAGFGNLESNTIY
TVSINEVSNRRPTKVNYSVSAFSLESRSSKKLACRLNGRNMAMRGESPSWIVPSLIEG
Download sequence
Identical sequences K3YTL4
XP_004953414.1.39314 Si017610m|PACid:19690537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]