SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017688m|PACid:19690286 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017688m|PACid:19690286
Domain Number 1 Region: 66-305
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-37
Family Kelch motif 0.0026
Further Details:      
 
Domain Number 2 Region: 6-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000000275
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017688m|PACid:19690286
Sequence length 346
Sequence
MESAPGHTPLIHGLPDEIALICLARVPRRFHNVLRCVSKRWRELLCSEEWRTCRKRNNLD
ESWIYVICRESGIKCYVLAPDPSSRSLRVMHIIEPPCSARQGVTIEALDKRLFFLGGCSW
LNEPTDEVYCYDASSNCWSTAAPMPTPRCYFVSASLTEKLYITGGLGLTDKSPNSWDIYD
SATDSWCAHKNPMLTPDIVKFVALDEELVTIHQAAWNRMYFAGIYDPLDRTWRGTENEIA
RCFSSPTVVVDETLYMLEQKLGTTLMMWQKDTKEWVMLGRLSDKVTRPPCQLVAIGRKIY
VIGRGLSVVTIDMDTAARVDGFVVTSSTGPLVEQDLSPERSRVITI
Download sequence
Identical sequences K3YTU2
Si017688m|PACid:19690286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]