SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017783m|PACid:19686762 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017783m|PACid:19686762
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000213
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si017783m|PACid:19686762
Sequence length 325
Sequence
MASTTTTTTTVEDLPADVLACALRRLDGRSLAAASCATAGLRALAADPDTWRALCLARWP
SLLAARPDLLSSSSAVSPQRLFADAFPFPCLPVDAAADAAPLAGPELPSELVSAVDLYHG
GAPLLSRVVETAASSTWFLSSPFRVDAVECKSPAPIVGLGLGPGRAGGAVAAPAELELSW
IVVEPRGGRAVNVSSRRPVAVDRHWYTGEALVRYAVVLGGCKFEATVTCSEETGSVREIS
LAVEDADGAAVSGEGTLRLLAAAMAGPRKGGDGQEETAKRRYEEFVRSKRVRKESKARKE
VLVDLCCSAVSAVAVLSFVAAVVLR
Download sequence
Identical sequences K3YU37
Si017783m|PACid:19686762 XP_004952658.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]