SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si017868m|PACid:19689226 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si017868m|PACid:19689226
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily F-box domain 0.0000000638
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si017868m|PACid:19689226
Sequence length 311
Sequence
MDAAAAAAEIYRLPEECVAYAISLTTPGDACHSSAVSPAFRTAADSDAVWARFLPPDHAA
VLARADEPVECESKKELFSRLCDTPVLLDGATMSFGLERRSGAKCFMLSARALSIAWGDD
PTCWIWTASLPGSRFPEVAELVDVCWLEISGKLSLSLLSPGTTYAAYLVFAIADDSYGLE
CHVGMLPPKATVTVVSGTSGKPAATSTEHAICLQHMQGEEEVAVHRRKQQYMRLRKGYGR
KMVTREADPDIRCPRRRGDGWVEVELGEFAVATGDGEDGGVVEVRLEEVDSRRWKRGLIV
QGIEIRPKHAC
Download sequence
Identical sequences K3YUC2
Si017868m|PACid:19689226 XP_012704299.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]