SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019103m|PACid:19689169 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si019103m|PACid:19689169
Domain Number - Region: 69-231
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0051
Family Tricorn protease domain 2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019103m|PACid:19689169
Sequence length 246
Sequence
MNDGPSWESQDIPCSQTDRKLFAAATKITVGDGSKTSFWDSGWRWSSISNPAQHAKKYPA
YPVLMSIICSSSAGTFKLFDPIIEKEYTLKNSSLVPCDDYFQMLLFAKHGWVLVLRGNKY
MYATNPFTGEMLELPEMPWLGHQFDGISFSSSPKSPDCVVCAVEKERRSENILLYVMVWH
AGDDHWTRVKMYDHTQFRTAYSNPVFYRDKFYCLGTRGNLGVFNPQSMKWRVLDKPGAIP
DDDPMP
Download sequence
Identical sequences K3YXV5
Si019103m|PACid:19689169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]