SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019156m|PACid:19686190 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019156m|PACid:19686190
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily F-box domain 0.000000000131
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si019156m|PACid:19686190
Sequence length 304
Sequence
MEGASIPEDLIIEKILPWLPAKSLVRFRSVCKAWNYEIPTRHFIELHRERSRPKIDLMPW
MQGYRFVASSRHLIVLGYRNGYLLSNPATKDILHLPPASWYKARDTYIHCTGFGFVSSLG
KYKLVSVSFGTGDTCTCDVFTVGIDDSWRTCKSPPFPVSTSHSMPYLNANLHMLSLGSID
FSGFKDEIWRVLLPKEFELREMRGFLCFVCCIPGRTVDVWMMRDYANGVWSKYLVIDGTH
LGIKKGLYGFPLEVMSDGRIFIEMDDGRWFYFDPKDGSFQLVGHPGRGARNAVYAENLVP
ILGF
Download sequence
Identical sequences K3YY06
Si019156m|PACid:19686190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]