SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019169m|PACid:19687991 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019169m|PACid:19687991
Domain Number 1 Region: 82-363
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000196
Family 28-residue LRR 0.055
Further Details:      
 
Weak hits

Sequence:  Si019169m|PACid:19687991
Domain Number - Region: 3-47
Classification Level Classification E-value
Superfamily F-box domain 0.00111
Family F-box domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019169m|PACid:19687991
Sequence length 423
Sequence
MQDILCHIHSLMPMRYAARVASVSRTFLRSWRSHPSLAFSNFDEVFGIGLKTFKLQIYDM
KYAPRDNLDSWLRIAVTPQIEVLFLDLRSMSAKYNFPCSLLSGESLRYLFLASCNFHPGI
ELGCLRSLTRLWLHKVHITDGELGCLLSNSFALEQLELYHCSKIICLKIPCLQQLHHLEV
LSCANLQVIESKATNLSSLSFKVDLRMQLSLGETSRIKKLYMSCSKVAFYARTELLSSMR
NLETLTCSIHEAVDTPMLPSKFLHLKFLNIVLDGGTFDYFSLISFLEASPSLETFVLRVL
PLRVECLSVFEDPSVLRTMPEQCHVKLRRVTIINFSSAKSMVELACHILESTTSLEHLTL
DTTFGIRRCSDNKSAKCLGMRRERLVEAQRALLAAQTYIKPKVPSTVEYNILEPCSRCHA
VEP
Download sequence
Identical sequences K3YY19
Si019169m|PACid:19687991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]