SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019176m|PACid:19689739 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019176m|PACid:19689739
Domain Number 1 Region: 117-374
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000353
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 2 Region: 17-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000000994
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019176m|PACid:19689739
Sequence length 409
Sequence
MMLSLALGLSSKRPRTTSRSPATPDGPDHLSPLPVEMVEEILRRLPLDDAVRTSALAKPW
RYRWAECPGLELVAGDPPAAVDAVLNRYTCNVSRAQLDVPEESYCKIDGWLRALATKGIR
YLVVCFTPVLLLRLPLLPSSLFSCRELTSLLLKHCDIPPLPPSFDSFPNLLALQLDDVSF
VENGERTFEALIAKCPSLRSLILLFPSIGSDHMHEGNYSDWTIRAPNLKHFIISAWQDYG
WRIDDLPLIEEARVHLEGPELPRILPGLSKVKNLSVEDLSLHTILITKSSTVLSMFCILR
NAPNLEDLRITSLHESEENDEVNMEELLNAQRTVGLFSRLKCFCLFESIGHTNEMQFIEF
LMSKATVLQEIEISVRDDGSKSPEVVFDELSQYKKASPQAEVIVNRYVS
Download sequence
Identical sequences K3YY26
Si019176m|PACid:19689739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]