SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019197m|PACid:19687119 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019197m|PACid:19687119
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily F-box domain 0.0000262
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019197m|PACid:19687119
Sequence length 268
Sequence
GDWTKLPPDLAAEIGGRRLRFDLTEYTHFRAVCKPWRQATDDPRVLHSRFLPRDWVVLRN
HNFFEETRCHHLLNVATGASIVGVALPELSGHRPLGYAEGLLVLRNTTSSGIRLLNPLTR
AVTDLPDISSVLANASNDALDSAYFSWGFGVIDGGSAAAAAASPATVVLLLREVPLLGDT
RWAPVDASELAGGAAKVTFQSVLSLHGRFYVSTSMGDVLTVELHPEPRLVYVIRQATTLP
ATSSYILAPSSNDAAAGMIMVRASMSDE
Download sequence
Identical sequences K3YY47
Si019197m|PACid:19687119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]