SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019243m|PACid:19686763 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019243m|PACid:19686763
Domain Number 1 Region: 89-184,227-309
Classification Level Classification E-value
Superfamily RNI-like 0.00000000051
Family Cyclin A/CDK2-associated p19, Skp2 0.09
Further Details:      
 
Domain Number 2 Region: 10-55
Classification Level Classification E-value
Superfamily F-box domain 0.000000000536
Family F-box domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si019243m|PACid:19686763
Sequence length 339
Sequence
MSPRDDAAAKRDRLSALPDDLLHRILRPLEARQAARHLSLLSRRWRRVWASSPFVTLKDK
DSAGSERFVNNLLLLRDPLDLQLALRGANAIGLPDRVFTCATLEEISLSSRARDFIAPKS
AVCLPRLKKLHLENVQIDPSAVEKLNSGWPSLEDLNLYQCWLGSFKISSESLKTLSITAC
VYDEIHVSAPNAGSLKITVSRRVYLSAMPSLVSAWVHCVGAADHLAPCAYDLIAALCNAQ
RLELFRFDVLLQDIVHKPATEGLSLSNLKSLYVGEWLVTDFYNALAFFIQRLKLLPPLPR
NLETLWIRLSKGDDVEEFRKMRSALKEKTKPREMEVVWF
Download sequence
Identical sequences K3YY93
Si019243m|PACid:19686763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]