SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019291m|PACid:19690129 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019291m|PACid:19690129
Domain Number 1 Region: 17-82
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000144
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si019291m|PACid:19690129
Domain Number - Region: 98-178,221-309
Classification Level Classification E-value
Superfamily YWTD domain 0.00497
Family YWTD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019291m|PACid:19690129
Sequence length 340
Sequence
DEHEDEHEDEEEQRAKANSAAQLMEEIVTEILARLPVKPLLRFRSVCKAWRAIISDPVFI
RAHLRCPASNWERSPRFVISPHTLDEDFGGEFNSLRYFSHCDGLVFAPTDTRLYVFNSAT
REAITLPDGYRNFLRVGGRGCCYCGGLGLDPRTGKYKAVQGFYRSWEPDTNLRTVMGMEV
LTIAGEDGEDWREIRNDPPYPWCPEPPRGILHLSLGEEEFGITKLPDSLDPSLDDDFILD
VLYGRDLCRVRALMNSLWQRRYSIELSSSFPCHTMSLPPFSNGIILWETDTVYCYDPATS
KLTTICELDRMRYQRVRKWKNLFGFNVRPFTESLVRITSS
Download sequence
Identical sequences K3YYE1
Si019291m|PACid:19690129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]