SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si019292m|PACid:19690217 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si019292m|PACid:19690217
Domain Number 1 Region: 82-352
Classification Level Classification E-value
Superfamily L domain-like 0.00000000122
Family Leucine rich effector protein YopM 0.055
Further Details:      
 
Weak hits

Sequence:  Si019292m|PACid:19690217
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily F-box domain 0.000523
Family F-box domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si019292m|PACid:19690217
Sequence length 423
Sequence
EIWFHIHSLMPMEDSARAACVSRTFLRSWRHHPYLILSKETLGLKPNASGKGDVWAFTTK
MDLILKNHSSAGVKTLELDVCECRDLNPCYLNDWLQIAITPRIESLTLVLPSKYEEEYNF
PCSLLFGVNGNLIRHLHLTYCAFRPTVGAGCLRSLTKLHLSSVRITGEELGMLEMIESKA
PNLSTFNFTGDNLVQLSLESLQVKNLDMDCLDEINFLNYSITKLPYMVPNLETLTLSSYN
EMVNTPTVAAKFHHLKYLEIYLDRCLSPEYDFWSLASFLDASPILETFILINSMESEPVF
EDASNMRQRPEHKYESLKDVMIFGFCSAKSMVELTCHILQNATSLESITLDTINDQDDED
NLGRCSLTPARKTGECCYLSNGMILEANKGLMAIQKYIAAKVPSTVELDVRGPCSRCHTL
ETR
Download sequence
Identical sequences K3YYE2
Si019292m|PACid:19690217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]